Tong Hao
for any questions regarding the database
David Hill
for any questions regarding the ORFeome project
Please contact Tong Hao with your questions or comments.
Please note: The web browser must be configured to accept cookies. And JavaScript must be enabled.
The isoform project is made possible through support from the High-Tech Fund of the Dana-Farber Cancer Institute, The Ellison Foundation (Boston, MA), and by grants from the National Cancer Institute, the National Human Genome Research Institute, and the National Institute of General Medical Sciences.
Isoforms | COG7_1 COG7_3 | Gene symbol | COG7 | Entrez gene ID | 91949 |
---|---|---|---|---|---|
Note: place cursor to view image in higher resolution. Click here to view in UCSC genome browser (top track, reference isoform in red) | |||||
Protein sequence | |||||
COG7_1: MDFSKFLADDFDVKEWINAAFRAGSKEAASGKADGHAATLVMKLQLFIQEVNHAVEETSHQALQNMPKVLRDVEALKQEASFLKEQMILV COG7_3: MDFSKFLADDFDVKEWINAAFRAGSKEAASGKADGHAATLVMKLQLFIQEVNHAVEETSHQALQNMPKVLRDVEALKQEASFLKEQMILV |